Protein Info for RR42_RS32110 in Cupriavidus basilensis FW507-4G11

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF08479: POTRA_2" amino acids 100 to 170 (71 residues), 46.2 bits, see alignment E=4.8e-16 PF17287: POTRA_3" amino acids 178 to 223 (46 residues), 44.6 bits, see alignment 1.1e-15 PF03865: ShlB" amino acids 228 to 542 (315 residues), 281.3 bits, see alignment E=1.9e-87

Best Hits

KEGG orthology group: K07326, hemolysin activation/secretion protein (inferred from 82% identity to reh:H16_B0248)

Predicted SEED Role

"Channel-forming transporter/cytolysins activator of TpsB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YE19 at UniProt or InterPro

Protein Sequence (583 amino acids)

>RR42_RS32110 peptide ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MPMNFRNARRKARGVPPFASLILTLPALAVAQALPAFPHTVPPVTPNAAIERRQEQRQDA
ARERALARPDVLTTSPADAANAGIAGPLILPAESPCLRIGTVRWEGAEDFAWLQAEAGIL
PAQCVGGKGLEAIQDYFSARLLAQGYMTTRVVIPEQNLAGGELRLRVVAGRLSGVKAAGA
PGWWRMALPTGPGGLVNQRDLDQGTENMRRLQGQADAGIDLVPGENPGDTELIIRPGTGK
RWHALVTGDNAGLDNTGRYQMGGTLTVDSPLFLYDSLTVSGSTNANAGNGAAGTRSSAIS
YSIPFGYWSAFFSANQSRYHQTVAGFESDIVYGGRSTQIEAGLGYVPWRNASGKTSLYAK
VFRKTASSTLDGIDIAVQHRDFVGFEAGAAHRQYLGSTVLDAGAAWRASLPAHSRSPGFV
LGEPGWDGKSEIVLANAGLMVPFQVAGERLRYQGSLRMQYARTRILPSDYFVIGNRYSVR
GFDEQLTLAAENGITWRNDLAWQLGNTGQEAFVGLDMGHVSGPSAGFLVGQTLMGAVIGA
RGRWAMGGYAALTYEVTLGRPLSKPEFFRTHRPGIAAQIGIEF