Protein Info for RR42_RS32075 in Cupriavidus basilensis FW507-4G11

Annotation: EmrB/QacA subfamily drug resistance transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 405 to 428 (24 residues), see Phobius details amino acids 442 to 463 (22 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 22 to 417 (396 residues), 251.2 bits, see alignment E=9.8e-79 PF07690: MFS_1" amino acids 26 to 417 (392 residues), 173.9 bits, see alignment E=2.3e-55

Best Hits

Swiss-Prot: 54% identical to MDTD_PECCP: Putative multidrug resistance protein MdtD (mdtD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: None (inferred from 82% identity to reu:Reut_B4865)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YTE8 at UniProt or InterPro

Protein Sequence (483 amino acids)

>RR42_RS32075 EmrB/QacA subfamily drug resistance transporter (Cupriavidus basilensis FW507-4G11)
MQDTPLSPPTSATADDHIRRIMLWVVAIGFFMQTLDSTIVNTALPSMARSLGESPLRMQS
VIIAYSLTMAVIIPASGWLADRFGTRTIFQTAIVLFVAGSLACAYSNSLTWLVVSRVVQG
VGGAMLLPVGRLAVLRTFPRDQYLQALSFVAIPGMVGPLIGPTLGGWLTQTFSWHWIFLI
NVPVGLLGGLATMRYMPNARLHGVAAFDLSGYLLLAISMLTISFSLDGLAELGFEHATVL
MLLIASMASLTAYVLHASRRRRPLFALRLFRIHTFSVGLLGNLFARIGNGAMPFLIPLTL
QVSLGYSPFQAGMMMLPITAAGMASKRLATSLIERHGYRKVLVTNTFLVGLAMASFALIS
PTQPLALVLVQLALFGMVNSIQFTAMNTVTLKDLGTAGASGGNSLLSMVQMLSMSLAVTS
AGALLATFQGTFGRHGATSALPAFHATFICVGLITSASAWIFLQLSPDVARPAGKGVEDA
TEM