Protein Info for RR42_RS32060 in Cupriavidus basilensis FW507-4G11

Annotation: protocatechuate 3,4-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02423: protocatechuate 3,4-dioxygenase, alpha subunit
  • amino acids 5 to 192 (188 residues), 212.5 bits, E=2.7e-67
• PF00775: Dioxygenase_C
  • amino acids 26 to 168 (143 residues), 65.7 bits, E=1.9e-22

Best Hits

KEGG orthology group: K00448, protocatechuate 3,4-dioxygenase, alpha subunit [EC: 1.13.11.3] (inferred from 78% identity to reh:H16_B2290)

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase alpha chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
• 4-sulfocatechol degradation (2/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aerobic toluene degradation (19/30 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

See A0A0C4YLJ6 at UniProt or InterPro

Protein Sequence (192 amino acids)

>RR42_RS32060 protocatechuate 3,4-dioxygenase (Cupriavidus basilensis FW507-4G11)
MLYATASQTVGPYLHIGLSGLDRADLTAEASELTGERIVIEGRVIDGKGDPVPDGMVEIW
QANPAGRYRHPDDARDGAETALVPGFTGFGRLPTGPDGSFRFVTVKPGPVPGPDGQPQAP
HIVVSLFMRGLLKHLSTRLYFPDEAQANARDWVLSQVPAARRHTLVAQQAGAGRLQWQVV
LQGQDETVFFDI