Protein Info for RR42_RS32035 in Cupriavidus basilensis FW507-4G11

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00106: adh_short" amino acids 8 to 196 (189 residues), 166.9 bits, see alignment E=7.8e-53 PF08659: KR" amino acids 9 to 162 (154 residues), 39.9 bits, see alignment E=8.6e-14 PF01370: Epimerase" amino acids 11 to 135 (125 residues), 23.3 bits, see alignment E=7.9e-09 PF13561: adh_short_C2" amino acids 14 to 200 (187 residues), 118.2 bits, see alignment E=9.2e-38

Best Hits

Swiss-Prot: 30% identical to 3BHD2_EGGLE: 3-beta-hydroxycholanate 3-dehydrogenase (NAD(+)) 2 (Elen_1325) from Eggerthella lenta (strain ATCC 25559 / DSM 2243 / JCM 9979 / NCTC 11813 / VPI 0255)

KEGG orthology group: None (inferred from 69% identity to reu:Reut_A1538)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR:Glucose/ribitol dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLI9 at UniProt or InterPro

Protein Sequence (269 amino acids)

>RR42_RS32035 short-chain dehydrogenase (Cupriavidus basilensis FW507-4G11)
MAANETGKTAVITGAGGGIGRALAHALAAQGVALVLADKDADALRRVHGELAHHPQAIAM
LPTDVAQAAQVEQLCARSFELLGRVDLLFNNAGVLATGACWELDAAVFERVLNVNLWSVI
HSLRVFVPRMAAQGSGHIVNIASMAGLAVGPWLAPYTVSKQGVVALSEGLAMELQAAGLP
LKVSVACPGPVATGIALDLPAGAQSGVGGMNQALRASIAQGMPAATMARHILDGVCAGDF
WILPHAEAAAAAQARANGIASGKAPAFAV