Protein Info for RR42_RS31960 in Cupriavidus basilensis FW507-4G11

Annotation: biphenyl 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 145 to 266 (122 residues), 57.2 bits, E=1.1e-19

Best Hits

Swiss-Prot: 35% identical to BPHC_PARXL: Biphenyl-2,3-diol 1,2-dioxygenase (bphC) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00462, biphenyl-2,3-diol 1,2-dioxygenase [EC: 1.13.11.39] (inferred from 84% identity to reu:Reut_A1557)

MetaCyc: 58% identical to 3,4-dihydroxy-9,10-secoandrosta-1,3,5(10)-triene-9,17-dione 4,5-dioxygenase (Comamonas testosteroni)
dioxygenase. [EC: 1.13.11.25]

Predicted SEED Role

"2,3-dihydroxybiphenyl 1,2-dioxygenase" in subsystem Biphenyl Degradation

MetaCyc Pathways

• 2-hydroxybiphenyl degradation (2/4 steps found)
• diphenyl ethers degradation (2/4 steps found)
• biphenyl degradation (2/5 steps found)
• carbazole degradation (2/5 steps found)
• androstenedione degradation I (aerobic) (16/25 steps found)
• superpathway of testosterone and androsterone degradation (17/28 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (20/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (20/47 steps found)

KEGG Metabolic Maps

• Biphenyl degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.39

Use Curated BLAST to search for 1.13.11.25 or 1.13.11.39

Sequence Analysis Tools

See A0A0C4YLH1 at UniProt or InterPro

Protein Sequence (298 amino acids)

>RR42_RS31960 biphenyl 2,3-dioxygenase (Cupriavidus basilensis FW507-4G11)
MMDIRALGYIVVESTDTERWRHYGEQVLGMACTNAPHGALYLKMDERDYRYLIVPGKQDR
YLASGWELAGEAAFNHALATLRAANVEVTHASEAERIQRRAQAVAWFADPSGNRHEIFWG
MRSDFLRFVSPIGVSCFVTDPLGAGHSVLPAPAFDETYAFLRDVMGFGLSDIFRARFTTD
PAEPEKRIHFLHCGNGRHHSLAIFEAPAPSGCVHVMAEVPDMGEVGRALDRAQQHGVALS
ATLGQHCNDRIVSFYMKTPGGFDLEYGYGGLVVDWSQHAAFEATRVSLWGHDFSIGYR