Protein Info for RR42_RS31860 in Cupriavidus basilensis FW507-4G11

Annotation: 4-hyroxy-2-oxovalerate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03217: 4-hydroxy-2-oxovalerate aldolase
  • amino acids 4 to 336 (333 residues), 553.8 bits, E=6.8e-171
• PF00682: HMGL-like
  • amino acids 5 to 261 (257 residues), 169.5 bits, E=1.1e-53
• PF07836: DmpG_comm
  • amino acids 273 to 334 (62 residues), 101.6 bits, E=1.4e-33

Best Hits

Swiss-Prot: 92% identical to HOA3_CUPNH: 4-hydroxy-2-oxovalerate aldolase 3 (bpHI) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01666, 4-hydroxy 2-oxovalerate aldolase [EC: 4.1.3.39] (inferred from 92% identity to cti:RALTA_B0399)

MetaCyc: 82% identical to 4-hydroxy-2-oxohexanoate aldolase (Comamonas testosteroni)
RXN-12735 [EC: 4.1.3.43]

Predicted SEED Role

"4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)" (EC 4.1.3.39)

MetaCyc Pathways

• L-tryptophan degradation IX (11/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (11/12 steps found)
• mandelate degradation to acetyl-CoA (15/18 steps found)
• meta cleavage pathway of aromatic compounds (9/10 steps found)
• catechol degradation I (meta-cleavage pathway) (5/5 steps found)
• catechol degradation II (meta-cleavage pathway) (6/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (6/7 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (3/6 steps found)
• androstenedione degradation I (aerobic) (16/25 steps found)
• 4-nitrotoluene degradation II (4/9 steps found)
• superpathway of aerobic toluene degradation (19/30 steps found)
• naphthalene degradation to acetyl-CoA (6/12 steps found)
• p-cumate degradation (3/8 steps found)
• superpathway of testosterone and androsterone degradation (17/28 steps found)
• p-cymene degradation (4/11 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (20/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (20/47 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Carbazole degradation
• Ethylbenzene degradation
• Fluorene degradation
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.39

Use Curated BLAST to search for 4.1.3.39 or 4.1.3.43

Sequence Analysis Tools

See A0A0C4YDX7 at UniProt or InterPro

Protein Sequence (340 amino acids)

>RR42_RS31860 4-hyroxy-2-oxovalerate aldolase (Cupriavidus basilensis FW507-4G11)
MSQRITVHDMTLRDGMHPKRHQISLDQMKTIARGLDEAGVPLIEVTHGDGLGGASVNYGF
PAHSDEAYLQAVLGELKQAKVSALLLPGIGTIEHLRMAHELGVHTIRVATHCTEADVSEQ
HIGMARKLGMDTVGFLMMAHMAPMATLVEQALLMESYGANCLYITDSAGHMLPHDVTAKL
TAVRQALRPDTELGFHGHHNLAMGIANSLAAVACGATRIDAAAAGLGAGAGNTPMEVFVA
VCERMGIETGVDVFRIADVAEDLVVPIMDQPIRIDRDALTLGYAGVYSSFLLFAKRAQAK
YGIPAREILVELGRQRLVGGQEDMIEDTAMTLARERGLLA