Protein Info for RR42_RS31855 in Cupriavidus basilensis FW507-4G11

Annotation: acetaldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03215: acetaldehyde dehydrogenase (acetylating)
  • amino acids 3 to 291 (289 residues), 473.1 bits, E=1.6e-146
• PF01118: Semialdhyde_dh
  • amino acids 5 to 117 (113 residues), 37.7 bits, E=2.5e-13
• PF09290: AcetDehyd-dimer
  • amino acids 130 to 267 (138 residues), 214.1 bits, E=8.2e-68

Best Hits

Swiss-Prot: 89% identical to ACDH2_CUPNH: Acetaldehyde dehydrogenase 2 (H16_B0596) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K04073, acetaldehyde dehydrogenase [EC: 1.2.1.10] (inferred from 89% identity to reh:H16_B0596)

MetaCyc: 76% identical to propanal dehydrogenase (Comamonas testosteroni)
RXN-12736 [EC: 1.2.1.87]

Predicted SEED Role

"Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.2.1.10)

MetaCyc Pathways

• L-tryptophan degradation IX (11/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (11/12 steps found)
• heterolactic fermentation (15/18 steps found)
• mandelate degradation to acetyl-CoA (15/18 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• meta cleavage pathway of aromatic compounds (9/10 steps found)
• catechol degradation I (meta-cleavage pathway) (5/5 steps found)
• ethanolamine utilization (5/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• catechol degradation II (meta-cleavage pathway) (6/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (6/7 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• L-threonine degradation IV (2/2 steps found)
• ethanol degradation I (2/2 steps found)
• mixed acid fermentation (12/16 steps found)
• (S)-propane-1,2-diol degradation (4/5 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
• 2-aminoethylphosphonate degradation I (2/3 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)
• pyruvate fermentation to ethanol III (2/3 steps found)
• sulfoacetaldehyde degradation IV (2/3 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (1/3 steps found)
• 2-deoxy-D-ribose degradation I (1/3 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (3/6 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• androstenedione degradation I (aerobic) (16/25 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• 1,2-propanediol biosynthesis from lactate (engineered) (2/6 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• superpathway of aerobic toluene degradation (19/30 steps found)
• naphthalene degradation to acetyl-CoA (6/12 steps found)
• p-cumate degradation (3/8 steps found)
• superpathway of purine deoxyribonucleosides degradation (2/7 steps found)
• superpathway of testosterone and androsterone degradation (17/28 steps found)
• triethylamine degradation (1/6 steps found)
• p-cymene degradation (4/11 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (20/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (20/47 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.10

Use Curated BLAST to search for 1.2.1.10 or 1.2.1.87

Sequence Analysis Tools

See A0A0C4YT98 at UniProt or InterPro

Protein Sequence (303 amino acids)

>RR42_RS31855 acetaldehyde dehydrogenase (Cupriavidus basilensis FW507-4G11)
MAKIKCALIGPGNIGTDLLYKLRRSTILEPVWMVGVDPASDGLARARELGLKTTDQGLDG
LLAHLAADDIRIAFDATSAYVHRQHSDQLTARGVRVIDLTPAAIGPFCVPPVNLDEHLGS
NAMNVNMVTCGGQATIPMVYAVSRVQAVAYGEIVATVSSRSVGPGTRRNIDEFTRTTAGA
IEQVGGARQGKAIIVINPAEPPLIMRDTIHCLTEDEPDVDAITASVHDMIAEVRQYVPGY
TLKNGPVFDGKRVSIFMEVEGLGDYLPRYAGNLDIMTAAAARTAERIGAAMLRGALPAMA
TTA