Protein Info for RR42_RS31825 in Cupriavidus basilensis FW507-4G11

Annotation: 3-oxoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 33 to 262 (230 residues), 103.8 bits, E=3.1e-33
• PF12697: Abhydrolase_6
  • amino acids 34 to 267 (234 residues), 84.3 bits, E=5e-27
• PF06342: DUF1057
  • amino acids 34 to 157 (124 residues), 21.5 bits, E=2.8e-08
• PF12146: Hydrolase_4
  • amino acids 34 to 261 (228 residues), 67.5 bits, E=2.9e-22
• PF00756: Esterase
  • amino acids 103 to 135 (33 residues), 26.4 bits, 1.4e-09

Best Hits

KEGG orthology group: None (inferred from 86% identity to reu:Reut_A1513)

MetaCyc: 49% identical to 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase (Comamonas testosteroni)
RXN-12718 [EC: 3.7.1.17]

Predicted SEED Role

"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)

MetaCyc Pathways

• androstenedione degradation I (aerobic) (16/25 steps found)
• superpathway of testosterone and androsterone degradation (17/28 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (20/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (20/47 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.- or 3.7.1.17

Sequence Analysis Tools

See A0A0C4YMX0 at UniProt or InterPro

Protein Sequence (282 amino acids)

>RR42_RS31825 3-oxoacyl-ACP reductase (Cupriavidus basilensis FW507-4G11)
MSSTSPAALPAGQTITTPDGLRLHYLDAGAGEPVVFIHGSGPGASGHSNFKHNAPAFAAA
GFRTVVVDLPGYGQSSKPADVEYTLDFFVAALRAQLLALALPRCVLVGNSLGGAIALKYA
LDYPEHVSRLVMMAPGGVEDRETYFRMEGIEKMVSLFTGGHMNPDTMRQLLTLLVHDATL
VTDALVDERMAVCKAQPREVLATMKVPNLTERLGEIACPVLGFWGTEDRFNPAGGALKFL
QGCRDARFVLINRCGHWVMVEHSDYFNRECLGFLADTAEAAV