Protein Info for RR42_RS31820 in Cupriavidus basilensis FW507-4G11

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00106: adh_short" amino acids 13 to 205 (193 residues), 207.4 bits, see alignment E=2.4e-65 PF08659: KR" amino acids 17 to 173 (157 residues), 46.2 bits, see alignment E=7.4e-16 PF13561: adh_short_C2" amino acids 19 to 259 (241 residues), 231.5 bits, see alignment E=1.6e-72

Best Hits

Swiss-Prot: 42% identical to LINC_SPHIB: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase (linB) from Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)

KEGG orthology group: None (inferred from 84% identity to reh:H16_B0601)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YP96 at UniProt or InterPro

Protein Sequence (261 amino acids)

>RR42_RS31820 short-chain dehydrogenase (Cupriavidus basilensis FW507-4G11)
MEYPFNLFDLRGKVAAITGAARGIGAETARVLAAAGAKVAVLDLLEADGQAAVRRIEAEG
GQAAFWKLDVSSEAEVGKVFGEIAARFGRLDILINNAGIDGVNAPTHELALAQWQRVMDV
NVTGTFLCTKHAIAHLERAGGGSIVNVSSMYGIVGGPDVPPYHASKAAVRMMAKTDAMLY
AGKNIRANSVHPGYIRTPMLEEVAHASGQGEGLFAYLGAQAPMGRLGEPRDIAAGILYLV
SDAARYVTGAELVIDGGYTAR