Protein Info for RR42_RS31815 in Cupriavidus basilensis FW507-4G11

Annotation: steroid delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13577: SnoaL_4
  • amino acids 12 to 67 (56 residues), 25.8 bits, E=1.9e-09
• PF02136: NTF2
  • amino acids 12 to 65 (54 residues), 33.2 bits, E=1.3e-11
• PF12680: SnoaL_2
  • amino acids 17 to 115 (99 residues), 63.9 bits, E=3.8e-21

Best Hits

Swiss-Prot: 39% identical to SDIS_PSEPU: Steroid Delta-isomerase (ksi) from Pseudomonas putida

KEGG orthology group: K01822, steroid delta-isomerase [EC: 5.3.3.1] (inferred from 74% identity to reh:H16_B0602)

Predicted SEED Role

"Steroid delta-isomerase"

MetaCyc Pathways

• progesterone biosynthesis (1/2 steps found)
• androgen biosynthesis (1/6 steps found)
• backdoor pathway of androgen biosynthesis (2/11 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (4/17 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (20/42 steps found)
• sitosterol degradation to androstenedione (2/18 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (4/22 steps found)
• 11-oxyandrogens biosynthesis (2/20 steps found)
• brassinolide biosynthesis II (1/20 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (20/47 steps found)
• cholesterol degradation to androstenedione III (anaerobic) (2/22 steps found)
• brassinolide biosynthesis I (1/25 steps found)
• superpathway of steroid hormone biosynthesis (2/28 steps found)
• superpathway of cholesterol degradation III (oxidase) (12/49 steps found)
• superpathway of C28 brassinosteroid biosynthesis (1/36 steps found)

KEGG Metabolic Maps

• Androgen and estrogen metabolism
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C21-Steroid hormone metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.1

Sequence Analysis Tools

See A0A0C4YLD6 at UniProt or InterPro

Protein Sequence (129 amino acids)

>RR42_RS31815 steroid delta-isomerase (Cupriavidus basilensis FW507-4G11)
MTMDASKSAGMKATLLDYVAAFNAADAERVVALFADDATVEDPVGSPVIAGRERILAFYR
HAASLGARLEVVAPPRGSHGNAAALSFAVYARMQGHSVRIDVTDVMTFGADGRITGMRAF
WGPDDVHPQ