Protein Info for RR42_RS31780 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 335 to 359 (25 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 356 (332 residues), 103 bits, see alignment E=1.7e-33 amino acids 250 to 428 (179 residues), 38.2 bits, see alignment E=8.7e-14 PF13347: MFS_2" amino acids 254 to 421 (168 residues), 29.7 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 86% identity to reu:Reut_B4859)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YMV4 at UniProt or InterPro

Protein Sequence (440 amino acids)

>RR42_RS31780 MFS transporter (Cupriavidus basilensis FW507-4G11)
MTGKATRIELLSLRTPQMRAFHLTWMAFFVCFFAWFACAPLMPVLKGEFGLTPDQIANIN
IAAVAVTILVRLAIGPLCDRFGPRRAYTGLLALGAIPVLGVAMAQSYEAFLFFRLLIGAV
GASFVITQYHTSVMFAPNVVGTANAAAAGWGNAGGGAAQALMPLLLGGVLMLGVSHTMGW
RLALLVPGVLMLIMAVLYWRYTQDCPQGDFKDLRARGIAIDSGKKGGWASFVAAAGNYRV
WMLFITYGACFGVEIFIHNVAATYYVDHFGLSLSSAGLAAASFGLLALFARALGGWLSDK
AALRRGLDARSMLLFVLILGEGLGLLWFAQAHNVVAAVAAMLGFGLFTHMACGATYALVP
FIDRKALGGVAGIIGAGGNVGAVAAGFLMKGLGGNLQQTLTVLGTAAMVSALCAIAVRFS
AEHKASEQALFDNALASSGS