Protein Info for RR42_RS31460 in Cupriavidus basilensis FW507-4G11

Annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details PF01810: LysE" amino acids 20 to 204 (185 residues), 120.7 bits, see alignment E=2.9e-39

Best Hits

Swiss-Prot: 42% identical to YGGA_AERSA: Putative amino-acid transporter YggA (yggA) from Aeromonas salmonicida

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 85% identity to rsl:RPSI07_mp0868)

Predicted SEED Role

"Arginine exporter protein ArgO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YL61 at UniProt or InterPro

Protein Sequence (211 amino acids)

>RR42_RS31460 amino acid transporter (Cupriavidus basilensis FW507-4G11)
MNTSLALSASLQGLALSLGLIVAIGAQNAFVLRQGLRREHVGSVVLLCAMADALLIAAGV
MGMAQALGERPGLARVLALAGAAFLAIYGWQALRRARHARPLKASDGGKGLSRGAALAQA
AAFTLLNPHVYLDTVLLVGSIGAQQPAALRGWFVAGASAASLFWFGLLGFGARWLAPWFA
RPRAWQVLDGLIGTTMFVLSALLVQRVLQGL