Protein Info for RR42_RS31305 in Cupriavidus basilensis FW507-4G11

Annotation: NADPH:quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02817: zinc-binding alcohol dehydrogenase family protein
  • amino acids 2 to 338 (337 residues), 487.1 bits, E=1.6e-150
• PF08240: ADH_N
  • amino acids 32 to 92 (61 residues), 28.8 bits, E=1.4e-10
• PF00107: ADH_zinc_N
  • amino acids 161 to 285 (125 residues), 50.8 bits, E=2.5e-17
• PF13602: ADH_zinc_N_2
  • amino acids 194 to 335 (142 residues), 68 bits, E=2.5e-22

Best Hits

Swiss-Prot: 47% identical to ZDH1_STAAN: Zinc-type alcohol dehydrogenase-like protein SA1988 (SA1988) from Staphylococcus aureus (strain N315)

KEGG orthology group: None (inferred from 82% identity to rme:Rmet_4370)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See A0A0C4YDN7 at UniProt or InterPro

Protein Sequence (338 amino acids)

>RR42_RS31305 NADPH:quinone reductase (Cupriavidus basilensis FW507-4G11)
MKAVGLTRYLPIDDPQSLVDVDIATPVPEGRDLLVKVAAISVNPVDAKVRAPKDKVEPAT
RVLGWDAAGTVAAVGPDVTLFKVGDPVFYAGSITRPGANSEFHLVDERIVGHKPALLDFA
QAAALPLTAITAWEALFDRLGVSPQGEHAGRSVLVIGGAGGVGSIGIQLAKTLAGLTVIA
TASRPESAAWCRDLGADHTIDHRGDMPAQLRKLGFAEVDYILCFNDTDRHFAAMATVIAP
QGKICSIVENSGPLAVGDLKSKSATFVWEFMFTRSMFGTPDMIEQYLLLNEVARLVDAGR
LRTTLGENLGRIDAANLRRAHAMLESGRTIGKLVLEGF