Protein Info for RR42_RS31215 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 252 to 269 (18 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details amino acids 632 to 651 (20 residues), see Phobius details amino acids 660 to 678 (19 residues), see Phobius details amino acids 684 to 705 (22 residues), see Phobius details amino acids 714 to 733 (20 residues), see Phobius details amino acids 739 to 759 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 79% identity to rme:Rmet_4386)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YL04 at UniProt or InterPro

Protein Sequence (773 amino acids)

>RR42_RS31215 membrane protein (Cupriavidus basilensis FW507-4G11)
MERVLAVAWLLLVIALTVHQLQFWRASRLDTDVMALLPTSQRTATADRVLRRLADGVSRE
IVVLVGAPDWARARAAADRFSAAAKPKASLLQPVDRIASFDLDAALAFYRPYRDRLLTDS
QRAMLRQADPDALSQQALTRLYQLSTGPRLTDWAADPIGLWQDWWLSRAAITRVHERDGR
AALSAEGKEWVLLTYRITKPAFSVSGNTDYGDVLQLGERAAAQGDDGVHVVAAGIPLHAE
AAASQANLEMNVIGWGSLAAVLLLVWLAFRSLRPIILVGLSLLIGTAAAVSATALVFDRV
HLITLVFGASLVGVAEDFGIHYFVSRQASPGVSPPQVMRRLLPGMALALSTSVVAYLALG
IAPFPGLRQMALFSAVGLVAAFLTVVFWFPLLDRGQLRQTRLSSWLTASLARWPRVGMDR
ASMLLLGALALFIAPGLWQVRVADDVRQLQSSPPALIEAQRTAGRLLGTPSPAQFLLVRG
DSPDQVLAREEAVKAALAGVVARGELEGFLAISDWVPSASRQHADATLTHGLEAAVRERV
ARAVGGAVGAPNAAAPDRVLTLPAWLANPVSETLRHLWLDREGQGYASVMLLRGLDKPAT
IALIEAAAAKVQGVEWVDRVADLSSLLKHYRVLMTWLLGAGALGVALLLAWRYGRASWRA
LVPTLLAAVFSVALLGWLHVPLQLFSVLALALLLGVGVDYGIFLLEHPGDGESWTAIVLG
AASTLLAFGLLALSSTPALHAFGMTMLSGVGAVWVLSPWFRPHAPHVPHGHTH