Protein Info for RR42_RS30925 in Cupriavidus basilensis FW507-4G11
Annotation: chitin deacetylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 38% identical to ARND_YERP3: Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (arnD) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
KEGG orthology group: None (inferred from 89% identity to reu:Reut_B3973)Predicted SEED Role
"Polymyxin resistance protein PmrJ, predicted deacetylase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YKV9 at UniProt or InterPro
Protein Sequence (296 amino acids)
>RR42_RS30925 chitin deacetylase (Cupriavidus basilensis FW507-4G11) MARIALKVDVDTLRGTREGVPALLAMLARVRAEATFLFSLGPDHTGWALRRVFRPGFLKK VSRTSVVSNYGLRTLMYGVLLPGPDIGRKGAAEMRAARAAGHECGIHTWDHVYWQDNVRE RDAAWTRRQMQSAFDRYVEIFGEAPPTHGAAGWQMNDEAFRQIDDWGMVYASDGRGTGPY IPTVDGVACRHVQMPTTLPTLDELIGVGDLTEDNVHHAVLRLSEDGRDHVFTLHTELEGG KLAPVFNRLLDGWRAQGHELVSMATLYRHIDRSALPELPVTWGAIEGRSGELILQP