Protein Info for RR42_RS30865 in Cupriavidus basilensis FW507-4G11

Annotation: tat pathway signal sequence

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF06672: DUF1175" amino acids 41 to 232 (192 residues), 251 bits, see alignment E=4.7e-79

Best Hits

Swiss-Prot: 63% identical to Y4490_PSEAE: Uncharacterized protein PA4490 (PA4490) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K09934, hypothetical protein (inferred from 74% identity to rsl:RPSI07_0466)

Predicted SEED Role

"FIG00638487: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YM89 at UniProt or InterPro

Protein Sequence (234 amino acids)

>RR42_RS30865 tat pathway signal sequence (Cupriavidus basilensis FW507-4G11)
MIAVSRGRRSMLAALALALALPLASGGRAWALSGLASDTPDADALDALQSAAFRAWFVRI
VGEQLRQGPTPRWYQRDCAGLVRFAVGEALKVHDARWLRANGMQGGTSARQLPPELSLSP
TQRTLGQRWTRADGSTGAYASALALVQGNSRFVARNVNLAQPGDLLFYDQGDEQHLMIWM
GQYLAYHTGTVTRADNGLRAVTLSRLMQWNDSRWQPQDGNPNFIGVFRFAFLSR