Protein Info for RR42_RS30565 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 64 to 88 (25 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details PF06912: DUF1275" amino acids 23 to 237 (215 residues), 145.1 bits, see alignment E=2.3e-46 PF06803: DUF1232" amino acids 282 to 318 (37 residues), 51.4 bits, see alignment 7.5e-18

Best Hits

KEGG orthology group: None (inferred from 73% identity to reh:H16_A2205)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YM36 at UniProt or InterPro

Protein Sequence (380 amino acids)

>RR42_RS30565 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MPITYLRNLTGRVRSPRANRQLAGYLSFVAGATNAGGFLAVQQYTSHMTGIVSAMADHLA
LGQVGLLLQGLGALLSFLAGAATSAVLINWARREHLNSEYALPLMLEAILLLCFGLLGGN
LGNHQWLFIPATVMVLCFIMGLQNAMITKISHAEIRTTHLTGMVTDIGIELGKLFYWNLA
KSDEARPPVLANRSRLRMLATLVTLFFFGGVVGALGFKQLGFSATLALAALLLVLAFVPV
VDDARAHGARLAANGRKWAREVLRDVHALWLAARDPRTPWYAKATALLVAGYALSPIDLI
PDFIPVLGYLDDVVLVPLGVMLAIRMIPPDLMREYRAAAVAAGQRPSSRVAAAVIIVLWI
GGAIVMAALLARYVPWLRSN