Protein Info for RR42_RS30535 in Cupriavidus basilensis FW507-4G11

Annotation: cobalt transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 22 to 300 (279 residues), 226.9 bits, see alignment E=1.6e-71 PF01545: Cation_efflux" amino acids 26 to 219 (194 residues), 170.6 bits, see alignment E=3.8e-54 PF16916: ZT_dimer" amino acids 224 to 300 (77 residues), 75.1 bits, see alignment E=3.9e-25

Best Hits

KEGG orthology group: None (inferred from 74% identity to rpi:Rpic_0577)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKN8 at UniProt or InterPro

Protein Sequence (316 amino acids)

>RR42_RS30535 cobalt transporter (Cupriavidus basilensis FW507-4G11)
MRNDEIIDEAEVETPAMAQAARRSTWVSVAVNILLTCMQLVAGVVAGSQALIADAIHSLS
DLVSDFVVLFASHHSRKGADADHQYGHQRFETAASLAIGLLLLAVGAGMLWSAVQKLEYP
ELIQPVKGVALWVALGALAAKESLFRYMLAVAERVRSSMLVANAWHARSDAASSLVVAVG
IGGNLLGYHMLDPVAALVVGLMVTRMGWKFSWDALHDLMDRAVDAQSIEAIRQAILATPG
VLGLHDLKTRKMGDAILVDVHLEIDGAMTVEEGHRIAVQARLAAMQIQDVLNVMTHVDPV
RVPRHQAEDPARAGAA