Protein Info for RR42_RS30350 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 136 to 159 (24 residues), see Phobius details PF08521: 2CSK_N" amino acids 17 to 136 (120 residues), 26.5 bits, see alignment E=9.1e-10 PF00512: HisKA" amino acids 215 to 279 (65 residues), 53.4 bits, see alignment E=3.4e-18 PF02518: HATPase_c" amino acids 331 to 436 (106 residues), 77 bits, see alignment E=2.3e-25

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 48% identity to rme:Rmet_5797)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD59 at UniProt or InterPro

Protein Sequence (439 amino acids)

>RR42_RS30350 histidine kinase (Cupriavidus basilensis FW507-4G11)
MRTIRAQLLAGLLGAMLACALVAGAAAYFKVRREANEVFDAQLQQAARMLPTHLQRDATP
PLDGSELDEEIVVQAWDVQGRQIYASHPVTLPRADLPGFHDLQAHGSEWRIYGVLAGDRY
VQAAQSVVFRRKLAASLSLGALLPILALVPVLGLLIHLVVRRSLRPVEEIARAVGSRSAN
TLAPLDAHGWPPELVPVVEALNALLARLQQSMDTQRAFVADAAHELRTPLTALKLQLQLA
LRADSEDKQKLALAKLGERLDRTTHLVAQLLTLARSEDGAPATQAPLADVRLRDVAVQVV
RELLPMAEAKDVDLGLDASAPECRVRGVDGDLFILLRNLADNAIRYTSPGGRVDLRIEWR
NGAPMLGVSDTGPGIAPAERDNVFRRFHRGAASDAHGSGLGLAIVQSIAARHGATVLLED
GPAGRGLTVAVVFPAQNGA