Protein Info for RR42_RS30325 in Cupriavidus basilensis FW507-4G11

Annotation: FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03566: FMN reductase
  • amino acids 6 to 178 (173 residues), 252.2 bits, E=1.2e-79
• PF02525: Flavodoxin_2
  • amino acids 6 to 135 (130 residues), 38.7 bits, E=9e-14
• PF03358: FMN_red
  • amino acids 6 to 147 (142 residues), 98.5 bits, E=2.9e-32

Best Hits

Swiss-Prot: 66% identical to SFNE_PSEPU: NADH-dependent FMN reductase SfnE (sfnE) from Pseudomonas putida

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 75% identity to cti:RALTA_B1390)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

• two-component alkanesulfonate monooxygenase (2/2 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (24/33 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (2/3 steps found)
• bacterial bioluminescence (5/8 steps found)
• dibenzothiophene desulfurization (1/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.29

Sequence Analysis Tools

See A0A0C4YSI0 at UniProt or InterPro

Protein Sequence (188 amino acids)

>RR42_RS30325 FMN reductase (Cupriavidus basilensis FW507-4G11)
MATPLKVVAVNGSAQQPSRTLALVQALLTELDSRLHLQSHIVNLGDIARPLGAALSRAEL
PAEIENQLVAIESADLLVVAAPVYRGSYPGHFKHLFDLVGQQALVDKPVLLGATGGSDRH
ALVLEHQLRPLFGFLQALTLPIGVYGSPGDFHNYQVSSAALAERIRLAADRCAPLFEASR
KLPLQRAA