Protein Info for RR42_RS29440 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 81 (42 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 134 to 159 (26 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 228 to 257 (30 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 274 (267 residues), 119 bits, see alignment E=1.1e-38

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 75% identity to rfr:Rfer_3499)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRZ0 at UniProt or InterPro

Protein Sequence (290 amino acids)

>RR42_RS29440 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MEILQLTISGIALGCIYALIALGFVLIYKATETVNFAQGEFMMLGAFAGVVLTMLGLPLV
LAVPLTVAGMAGFGMLVERLAIRPILGQPQFTVVMLTIGMGYVMRGLITMVPGIGAGTHT
LPVPYQGMVWRTGALVLSVEQVAVIGVTAALCVVLYLVFRYSRIGVAMQASSQNQLAAYY
MGIPVRRLNGLVWGLSASVAAIAGLLLAPITFVHASMGMLGLKAFPAAVVGGFGSLPGAI
VGGLVIGVVESLAGFYLPEGFKDVAAYVVVLIMLVVKPNGLFGENLRKKV