Protein Info for RR42_RS29055 in Cupriavidus basilensis FW507-4G11

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 153 to 172 (20 residues), see Phobius details PF02311: AraC_binding" amino acids 29 to 167 (139 residues), 45.3 bits, see alignment E=1.5e-15 PF07883: Cupin_2" amino acids 37 to 91 (55 residues), 32.8 bits, see alignment E=9.2e-12 PF12833: HTH_18" amino acids 213 to 291 (79 residues), 75.9 bits, see alignment E=5.1e-25 PF00165: HTH_AraC" amino acids 255 to 291 (37 residues), 31.7 bits, see alignment 2.6e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to reu:Reut_B5021)

Predicted SEED Role

"Transcriptional regulator PobR, AraC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJS2 at UniProt or InterPro

Protein Sequence (304 amino acids)

>RR42_RS29055 AraC family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MKTVPTYSLYGVNSNEPLLEQLHFESIPERSGVNDWEIKPHRHERFFQVLYVHQGGGRAL
LDDREYPLGARTVVTVPPRCVHGFRFTPDVDGIVITMTDHYLHTLLAGVPDALPLFERPY
HDPFGDPAGSERDDATVLAGALELFRAEMNAVSLWRGAALSALLSLLLVGIARRACGAGA
TGAQPAGRTARHFQQFQQLVEARFRNHQDLAGYAGTLGISPTQLNRICQQLAGRSALQLI
HSRLIVEAQRDLLYSDLDIKQIASTLGFADAAYFARFFAKHVGQTPSAFRQHGRARLPAP
QAAR