Protein Info for RR42_RS29005 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details PF06127: Mpo1-like" amino acids 1 to 148 (148 residues), 71.3 bits, see alignment E=3e-24

Best Hits

KEGG orthology group: None (inferred from 79% identity to rme:Rmet_4743)

Predicted SEED Role

"FIG028593: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJR6 at UniProt or InterPro

Protein Sequence (165 amino acids)

>RR42_RS29005 membrane protein (Cupriavidus basilensis FW507-4G11)
MKTLIDHLANYAAYHRDARNVFSHFIGIPMIVLAVTTLLGRPAMPLDAGPAYLTPAMVVY
GLSCLFYLRLSAGFGLAMTVILAGFVYAGGAIAALSTGAWLAWGIGLFVAGWLIQFVGHY
YEGRKPAFVDDLAGLLVGPLFLVAEVAFAMGLARDTREAVSAHAH