Protein Info for RR42_RS28985 in Cupriavidus basilensis FW507-4G11

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 9 to 204 (196 residues), 174.3 bits, E=3.1e-55
• PF08659: KR
  • amino acids 12 to 163 (152 residues), 55.1 bits, E=1.4e-18
• PF13561: adh_short_C2
  • amino acids 17 to 253 (237 residues), 223.6 bits, E=4.1e-70

Best Hits

Swiss-Prot: 44% identical to DHRS4_BOVIN: Dehydrogenase/reductase SDR family member 4 (DHRS4) from Bos taurus

KEGG orthology group: None (inferred from 92% identity to reu:Reut_B4043)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A0C4YML6 at UniProt or InterPro

Protein Sequence (254 amino acids)

>RR42_RS28985 short-chain dehydrogenase (Cupriavidus basilensis FW507-4G11)
MSLFDLTGKVAVVTGSSRGIGRAIAEQMAVQGAKVVISSRKAEACQEVVDAINARHGAGT
AIAVPANISSKEDLQRLVDQTNSTFGKIDVLVCNAASNPYYGPMSGVTDEQFRKVLDNNV
ISNHWLIQMVAPQMLERKDGSIIIVSSIGGLRGSPTIGVYNVSKAADFQLARNLAVEFGP
SNVRVNCIAPGLIRTDFAKALWEDPERYKLSTQGAPLRRIGEPVEIAGAAVFLASSASTF
MTGQAMVVDGGVTI