Protein Info for RR42_RS28900 in Cupriavidus basilensis FW507-4G11

Annotation: acetone carboxylase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08882: Acetone_carb_G
  • amino acids 47 to 159 (113 residues), 190.6 bits, E=3.8e-61

Best Hits

Swiss-Prot: 62% identical to ACXC_XANP2: Acetone carboxylase gamma subunit (acxC) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K10856, acetone carboxylase, gamma subunit [EC: 6.4.1.6] (inferred from 83% identity to bph:Bphy_6152)

MetaCyc: 62% identical to acetone carboxylase gamma subunit (Xanthobacter autotrophicus Py2)
Acetone carboxylase. [EC: 6.4.1.6]

Predicted SEED Role

"Acetone carboxylase, gamma subunit (EC 6.4.1.6)" (EC 6.4.1.6)

MetaCyc Pathways

• acetone degradation II (to acetoacetate) (1/1 steps found)

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.6

Use Curated BLAST to search for 6.4.1.6

Sequence Analysis Tools

See A0A0C4YRM6 at UniProt or InterPro

Protein Sequence (168 amino acids)

>RR42_RS28900 acetone carboxylase subunit gamma (Cupriavidus basilensis FW507-4G11)
MSTYTSEQVKNLVDGKLDWDTTLRMLSMPKDAARFQLYVQALQKKLDWADRIVLPLSPHM
FIVQQSKTKKWVTQCDCGHVFCDYRENWKLHANVYVRDTDEAMAEVYPHLMAPDTQWQVY
REYYCPKCGTMHDVEAPTPWYPVIHDFEPDIEAFYTDWVKLPLPERAD