Protein Info for RR42_RS28885 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details PF01595: CNNM" amino acids 5 to 196 (192 residues), 160.6 bits, see alignment E=4.8e-51 PF00571: CBS" amino acids 217 to 266 (50 residues), 26.2 bits, see alignment 1.2e-09 amino acids 281 to 330 (50 residues), 28 bits, see alignment 3.3e-10 PF03471: CorC_HlyC" amino acids 345 to 424 (80 residues), 71.8 bits, see alignment E=5.7e-24

Best Hits

Swiss-Prot: 43% identical to Y260_SYNY3: UPF0053 protein sll0260 (sll0260) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03699, putative hemolysin (inferred from 87% identity to reu:Reut_B4026)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJQ3 at UniProt or InterPro

Protein Sequence (437 amino acids)

>RR42_RS28885 membrane protein (Cupriavidus basilensis FW507-4G11)
MEIAILLVLILINGLFAMSEIALMTARKARLQRRIEEGDRGAIEAIKLGEDPTRFLSTVQ
IGITSIGVLNGVVGESTLAQPLGVWLQGFGMQASTAGWVATTIVVAGLTYFSIVLGELVP
KRLGQMAPETIARLVSRPISFLALASTPFVKLLSSSTRLVLRMLGVKSGRGPAVTEEEIH
ALLVEGSEAGVIEQHEHTMVRNVFRLDDRQLTSLMVPRGDVVCLDVEVPLEENLRRIEES
DHSRFPVVRGGMHDMLGVVSARQLLARRLRGEPTDLATVAQPPVFVPESVTGMELLENFR
ISGGQIAFVIDEYGEVLGLVTLQDLIEAITGEFKQDGVGEEWAVQREDGSWLLDGLIPIP
ELKDRIGLRQVPEEDKERYHTLSGMLLLLLGRLPQTTDTVRWGDWKFEIVDMDGKRIDKV
LASRVLPDDGADAETTG