Protein Info for RR42_RS28865 in Cupriavidus basilensis FW507-4G11

Annotation: 2-dehydro-3-deoxyphosphogluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
  • amino acids 10 to 209 (200 residues), 258.3 bits, E=1.9e-81
• PF01081: Aldolase
  • amino acids 10 to 202 (193 residues), 245.9 bits, E=1.2e-77

Best Hits

Swiss-Prot: 51% identical to ALKH_ECO57: KHG/KDPG aldolase (eda) from Escherichia coli O157:H7

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 82% identity to reh:H16_B1213)

MetaCyc: 51% identical to KHG/KDPG aldolase (Escherichia coli K-12 substr. MG1655)
RXN-13990 [EC: 4.1.3.42]; 2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.3.42, 4.1.2.14, 4.1.2.55]; Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 4.1.3.42, 4.1.2.14, 4.1.2.55, 1.1.1.38, 1.1.1.40, 1.1.1.83, 4.1.1.112]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• TCA cycle III (animals) (10/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• gluconeogenesis III (11/12 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• gentisate degradation II (4/4 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• formaldehyde assimilation I (serine pathway) (10/13 steps found)
• Entner-Doudoroff shunt (2/2 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• methylaspartate cycle (14/19 steps found)
• D-malate degradation (1/1 steps found)
• D-fructuronate degradation (3/4 steps found)
• L-carnitine degradation II (2/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• methylgallate degradation (4/6 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
• trans-4-hydroxy-L-proline degradation I (3/5 steps found)
• D-galacturonate degradation I (3/5 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (5/8 steps found)
• chitin deacetylation (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• reductive TCA cycle I (7/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• superpathway of β-D-glucuronosides degradation (4/7 steps found)
• D-glucosaminate degradation (1/3 steps found)
• superpathway of vanillin and vanillate degradation (6/10 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (2/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (3/7 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of hexuronide and hexuronate degradation (5/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• reductive TCA cycle II (6/12 steps found)
• syringate degradation (5/12 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (15/31 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Carbon fixation in photosynthetic organisms
• Glyoxylate and dicarboxylate metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.40, 1.1.1.83

Use Curated BLAST to search for 1.1.1.38 or 1.1.1.40 or 1.1.1.83 or 4.1.1.112 or 4.1.2.14 or 4.1.2.55 or 4.1.3.16 or 4.1.3.42

Sequence Analysis Tools

See A0A0C4YMJ6 at UniProt or InterPro

Protein Sequence (214 amino acids)

>RR42_RS28865 2-dehydro-3-deoxyphosphogluconate aldolase (Cupriavidus basilensis FW507-4G11)
MQSQSPSLIERLVNVPVIPVLEFSSVDEALHVSEALIGGGLPVLEITLRTPVALDAIKAV
AAAFPQACVGAGTVLTAADLKAVSDAGAQFAVSPGLTPALAVAAQGAGVALLPGVATASE
AMAAMEAGFKFLKFFPAEASGGVPMLKSLYGPFAQLRFCPTGGIDLARAPTYLALPNVVC
VGGSWVVPKDAVAKGDWARVRTLAQEAAALRKSA