Protein Info for RR42_RS28450 in Cupriavidus basilensis FW507-4G11

Annotation: serine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02035: D-serine ammonia-lyase" amino acids 24 to 448 (425 residues), 503.4 bits, see alignment E=2.5e-155 PF00291: PALP" amino acids 84 to 403 (320 residues), 131.4 bits, see alignment E=2.3e-42

Best Hits

Swiss-Prot: 68% identical to SDHD_ACIET: Probable D-serine dehydratase (dsdA) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K01753, D-serine dehydratase [EC: 4.3.1.18] (inferred from 68% identity to dia:Dtpsy_1624)

Predicted SEED Role

"D-serine dehydratase (EC 4.3.1.18)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.18

Use Curated BLAST to search for 4.3.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC93 at UniProt or InterPro

Protein Sequence (457 amino acids)

>RR42_RS28450 serine dehydratase (Cupriavidus basilensis FW507-4G11)
MNQPLAMNPSTAAGPHAAAALRASLAAATPLLWCNPARAVTPPPVQAAGEHSISLADVEA
AQARFARFAPLLSALFPELAGTHGVIESPLVAVPSMQTALGLPHSQGRLWVKADHSLPVA
GSIKARGGIHEVLEFAENLALRHGLVGPGRNEPEHYLALREPAARALFGRYQVAVGSTGN
LGLSIGVMASALGFRAAVHMSSDAKAWKKARLRNRGVEVVEHAGDYEDAVAAGRRQAQQD
EFTYFVDDERSLSLLLGYSAAALHLRQQLAAHAIRVDAEHPLFVYLPCGVGGAPAGITFG
MRQLFGPHVHCVFAEPVQSPCFLVQMMAGAGNPSVYDFGLSNSTQADGLAVPRASELAAG
VMRPLLSGVFTVADDTLFEHLALAWRTQGLRIEPSAAAGFSGPRMLCESPAGRDYLARHQ
LEAMMPQATHLVWTTGGLFVPPAEYQGFLDKAAALAA