Protein Info for RR42_RS28440 in Cupriavidus basilensis FW507-4G11

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF01168: Ala_racemase_N" amino acids 34 to 259 (226 residues), 96.3 bits, see alignment E=2.2e-31 PF14031: D-ser_dehydrat" amino acids 276 to 374 (99 residues), 59.3 bits, see alignment E=4.7e-20

Best Hits

Swiss-Prot: 56% identical to DTA_ARTSP: D-threonine aldolase from Arthrobacter sp.

KEGG orthology group: None (inferred from 68% identity to rme:Rmet_4194)

Predicted SEED Role

"low-specificity D-threonine aldolase" in subsystem Serine-glyoxylate cycle or Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKW7 at UniProt or InterPro

Protein Sequence (392 amino acids)

>RR42_RS28440 alanine racemase (Cupriavidus basilensis FW507-4G11)
MTLPDSTSATLQLGACAIVGQPAATIDTPALMLDLDAFERNLAQMQQAADRAGVQLRPHA
KAHKCPEIALAQIARGAAGICCQKVSEALPFVQAGVRDIHISNEIAGAAKAALLARLARH
ARMSVCVDDARQVAALAQAAAQAGSHIGVFVEIDVGQGRCGVADAPAALRLVQAIGAHPQ
LAFRGLQAYHGGIQHVRDYAARRQAAADAAARTATIVAELAEAGVACATVTGGGTGSVEF
DLKSGVYTEIQPGSYVFMDADYGRNDYGGALRFEHSLFIATTVMSVAAATRPSPRVVLDA
GLKSMAVDSGLPLVWGANGQDHALAYVAANDEHGIVEPVPGTSAAGLPGLGSQVLLVPGH
CDPTLNLYDEIVGVRGQAVDSLWPVSARGLSR