Protein Info for RR42_RS28380 in Cupriavidus basilensis FW507-4G11

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF02771: Acyl-CoA_dh_N" amino acids 6 to 116 (111 residues), 79.3 bits, see alignment E=6e-26 PF02770: Acyl-CoA_dh_M" amino acids 120 to 212 (93 residues), 54.5 bits, see alignment E=2.2e-18 PF00441: Acyl-CoA_dh_1" amino acids 237 to 367 (131 residues), 87 bits, see alignment E=2.9e-28 PF08028: Acyl-CoA_dh_2" amino acids 241 to 345 (105 residues), 36.1 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 72% identity to reu:Reut_B4789)

MetaCyc: 47% identical to pimeloyl-CoA dehydrogenase small subunit (Rhodopseudomonas palustris)
Pimeloyl-CoA dehydrogenase. [EC: 1.3.1.62]

Predicted SEED Role

"Acyl-CoA dehydrogenase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.1.62 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC84 at UniProt or InterPro

Protein Sequence (375 amino acids)

>RR42_RS28380 acyl-CoA dehydrogenase (Cupriavidus basilensis FW507-4G11)
MDFSYTDEHIALQDAVRRFCDGEYPAHQRGNPEAPALCAQRWASMAELGLLGLPFDSEVG
GSGQGTVELMLVAQELGRCLGGGAWLSSVVLAGQLLDQVGTARQRGRWLPEVASGKCRLA
LAASESDSRYSLSRVRTRAQASADGWRIEGRKTLVLEGGDANAFIVVARTAGDVADDDGL
TLFLVDAKTPGVAVHGFATLDGRQAAHVVLDGVQVGSDAMLGEAGRALPLIEAATDRASA
VLCAEAAGALEALIDLTAEHLKTRKQFGTTLARFQVLQHRVADMLIALEQSKSMACAAAM
AVDAGEPVQRRRLVSAAKVVVGQAGRQVSQWAIQLHGAMGMTDECRVGHYAKRLLVINQL
FGDASHHLQRFAQRP