Protein Info for RR42_RS28375 in Cupriavidus basilensis FW507-4G11

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF02771: Acyl-CoA_dh_N" amino acids 9 to 117 (109 residues), 54.9 bits, see alignment E=1.6e-18 PF02770: Acyl-CoA_dh_M" amino acids 126 to 222 (97 residues), 67.7 bits, see alignment E=1.3e-22 PF00441: Acyl-CoA_dh_1" amino acids 234 to 398 (165 residues), 61.8 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 88% identity to reu:Reut_B4790)

MetaCyc: 48% identical to pimeloyl-CoA dehydrogenase large subunit (Rhodopseudomonas palustris)
Pimeloyl-CoA dehydrogenase. [EC: 1.3.1.62]

Predicted SEED Role

"Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13)" (EC 1.3.99.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-, 1.3.99.13

Use Curated BLAST to search for 1.3.1.62 or 1.3.99.- or 1.3.99.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRG4 at UniProt or InterPro

Protein Sequence (402 amino acids)

>RR42_RS28375 acyl-CoA dehydrogenase (Cupriavidus basilensis FW507-4G11)
MQLEFSAADDAFRQEVRAFVKARLPSDIKRKVELGLRLEHADYVTWFRILEARGWITPGW
PVEHGGPGWSHLQRYIFDEETLLGGAPRIIASGIQMLGPVLIAFGTPEQKARYLPDIRHS
NTWWAQGFSEPGAGSDLAAVRTTAVLEPDGRHFVVNGHKVWTSYAHWCSMMFALVRTDPD
AAKPQEGISFILIDMASPGVEVRPIRMLEGGTDLNECYLDNVRVPVENLVGEINKGWSYG
KYLLGHERTGIAGIGSCKQQLARARTLADEQGLGDDAVLQCRLAQFEIELMALEYTALRL
LGDNQRSRVPSVEASMLKVRGTELRQAIYELLVEVAGPHAVPFDEAAMLGAAGYEQSTAA
DAASPPTLAALAANYLDSRKLSIYGGVNEVQRNLISKAFLAA