Protein Info for RR42_RS28305 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): L-threonine:H+ symporter
Rationale: Specifically important for utilizing threonine as a carbon source
Original annotation: proline-specific permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 369 to 394 (26 residues), see Phobius details amino acids 415 to 433 (19 residues), see Phobius details amino acids 439 to 457 (19 residues), see Phobius details PF00324: AA_permease" amino acids 27 to 463 (437 residues), 417.9 bits, see alignment E=5.1e-129 PF13520: AA_permease_2" amino acids 30 to 440 (411 residues), 129.6 bits, see alignment E=1.6e-41

Best Hits

Swiss-Prot: 53% identical to YTNA_BACSU: Uncharacterized amino acid permease YtnA (ytnA) from Bacillus subtilis (strain 168)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 74% identity to mno:Mnod_4992)

MetaCyc: 49% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRF7 at UniProt or InterPro

Protein Sequence (472 amino acids)

>RR42_RS28305 L-threonine:H+ symporter (Cupriavidus basilensis FW507-4G11)
MTDVRKLLNEERVHEEKDLHRGLKDRHIQMIAIGGAIGVGLFLGAGRAIAIAGPGLMLSY
AIGGVAIFFIMRALGELLLYRPVSGSFATYAEEFVGPFAGFATGWSYWFMWVVTGMAEIT
AVAVYVHYWFPDVPQWIPALATLAVLYLVNCVAVAVFGELEFWFALIKVVTIVAMIVIGL
AIIFFGVTPLGPTASFSNLWTHGGFMPFGTLGVVLTLQIVMFAYQGVELIGVTAGEAQNP
EKVLPHATNGVVWRILIFYVGALIIMMALVPWNELKPGVSPFVYVFERIGVPGAAAIVNL
VVITAAASSCNSGIFSTGRMLYTLAQFGQAPRAFGRVSSKHVPSIAITFSAALMGIGVLL
NYIVPEQVFVWVTSISLVGSLWTWSIIMIAHLGYRKAIAAGRVKAVAFRMPGAPYANWLV
VAFMIAVAVLLSLDPGTRVALYVAPVWFALLGIGYRFTKSRALLEGHVQKSA