Protein Info for RR42_RS28300 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): L-threonine 3-dehydrogenase (EC 1.1.1.103)
Rationale: Specifically important for: L-Threonine. The first step in Thr catabolism (SEED_correct)
Original annotation: NAD-dependent epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF04321: RmlD_sub_bind" amino acids 6 to 162 (157 residues), 50.8 bits, see alignment E=4.6e-17 PF01370: Epimerase" amino acids 7 to 242 (236 residues), 108.4 bits, see alignment E=1.4e-34 PF16363: GDP_Man_Dehyd" amino acids 8 to 169 (162 residues), 65.1 bits, see alignment E=2.9e-21 PF01073: 3Beta_HSD" amino acids 8 to 124 (117 residues), 30.1 bits, see alignment E=9e-11 PF02719: Polysacc_synt_2" amino acids 8 to 124 (117 residues), 26.6 bits, see alignment E=1.2e-09 PF07993: NAD_binding_4" amino acids 68 to 211 (144 residues), 21.3 bits, see alignment E=4.7e-08

Best Hits

Swiss-Prot: 46% identical to TDH_BOVIN: L-threonine 3-dehydrogenase, mitochondrial (TDH) from Bos taurus

KEGG orthology group: None (inferred from 80% identity to rpi:Rpic_4846)

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.103

Use Curated BLAST to search for 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKU6 at UniProt or InterPro

Protein Sequence (324 amino acids)

>RR42_RS28300 L-threonine 3-dehydrogenase (EC 1.1.1.103) (Cupriavidus basilensis FW507-4G11)
MTKPARVLIIGANGQLGTELASALADRYGKQNVVTSDMVPHGRHLHLTHEMLDVTDRAHL
RDVIERHGITQIYHLAAALSATGEKSPTWAWQLNMNGLLNVLEAARHQKLDKVFWPSSIA
AFGPTTPPDGTPQSTIMEPKTVYGISKLAGEGWCRWYFENHGVDVRSLRYPGLISYKTPP
GGGTTDYAIDIFHSALRAQPYACFLEKDEALPMMYMPDAVRATMELMEAPRASISERGSY
NLAGLSFTPGEIANEIRRHCPGFDVRYEPDFRQEIAAGWPDSIDDSVARRDWNWRPEFGL
KEMVADMLKNLATLNQGSALECVS