Protein Info for RR42_RS28290 in Cupriavidus basilensis FW507-4G11

Annotation: DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF13560: HTH_31" amino acids 17 to 74 (58 residues), 42.4 bits, see alignment E=1.7e-14 PF12844: HTH_19" amino acids 18 to 79 (62 residues), 30.8 bits, see alignment E=5.6e-11 PF13443: HTH_26" amino acids 20 to 77 (58 residues), 25.2 bits, see alignment E=4.1e-09 PF01381: HTH_3" amino acids 22 to 75 (54 residues), 54.3 bits, see alignment E=2.9e-18 PF07883: Cupin_2" amino acids 126 to 193 (68 residues), 30.7 bits, see alignment E=5.2e-11

Best Hits

KEGG orthology group: None (inferred from 81% identity to rpf:Rpic12D_3771)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJH8 at UniProt or InterPro

Protein Sequence (198 amino acids)

>RR42_RS28290 DNA-binding protein (Cupriavidus basilensis FW507-4G11)
MTQVPPSEAFAEGPPVIGARLQLLRQARKLSLDELSRRAGVSKSMLSQVERNLANPTVAV
LWRLANALGIGLAEFLSGEQADKPTPTVTVIPAHSIPVIRSPDGKCELKILGPVDLASRV
EWYELSIHPGGVLASEPHESGSKEHLSVMSGCVTVQSGPSEKKVRHGESARYPADVQHAI
SNPGKTMATALLVVEYAQ