Protein Info for RR42_RS28195 in Cupriavidus basilensis FW507-4G11

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF13489: Methyltransf_23" amino acids 38 to 170 (133 residues), 50.2 bits, see alignment E=1.1e-16 PF01209: Ubie_methyltran" amino acids 38 to 167 (130 residues), 50.3 bits, see alignment E=9.6e-17 PF05175: MTS" amino acids 40 to 123 (84 residues), 30.5 bits, see alignment E=1.2e-10 PF01135: PCMT" amino acids 49 to 119 (71 residues), 21.8 bits, see alignment E=6.4e-08 PF06325: PrmA" amino acids 49 to 123 (75 residues), 26.1 bits, see alignment E=2.6e-09 PF13847: Methyltransf_31" amino acids 50 to 165 (116 residues), 66.3 bits, see alignment E=1.2e-21 PF13649: Methyltransf_25" amino acids 53 to 147 (95 residues), 77.7 bits, see alignment E=4.3e-25 PF08241: Methyltransf_11" amino acids 54 to 151 (98 residues), 71.2 bits, see alignment E=4.2e-23 PF08242: Methyltransf_12" amino acids 54 to 149 (96 residues), 52.7 bits, see alignment E=2.7e-17

Best Hits

KEGG orthology group: None (inferred from 74% identity to vap:Vapar_1991)

Predicted SEED Role

"Methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRD1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>RR42_RS28195 SAM-dependent methyltransferase (Cupriavidus basilensis FW507-4G11)
MDVTQRAESEQAALWRGRSGRAWVEAQAPLDQMFKPFEDLLVKAACTGAGRRVLDVGCGT
GGTTLAVARRLGAKGHCTGADISDPMIAAARARAEREDITARFIRADVQNHAFEPASFDL
IISRFGVMFFDNPVLAFKNLRRAARDGADLCFVAWRSAAENPFMTTAERAAAPLLPSLPA
RRPGAPGQFSFAHGHRVSSVLEESGWAEIDIRPLDVECTFPESELVGYLSRLGPVGLILQ
EADERTRAQVMETVRAAFDPYVHGPEVRYTAACWMVRARAPASAAPKEAANA