Protein Info for RR42_RS27885 in Cupriavidus basilensis FW507-4G11
Annotation: 2-keto-4-pentenoate hydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to MHPD_COMTE: 2-keto-4-pentenoate hydratase (mhpD) from Comamonas testosteroni
KEGG orthology group: K02554, 2-keto-4-pentenoate hydratase [EC: 4.2.1.80] (inferred from 70% identity to bav:BAV0598)MetaCyc: 63% identical to 2-hydroxypentadienoate hydratase (Escherichia coli K-12 substr. MG1655)
2-oxopent-4-enoate hydratase. [EC: 4.2.1.80]
Predicted SEED Role
"2-keto-4-pentenoate hydratase (EC 4.2.1.80)" (EC 4.2.1.80)
MetaCyc Pathways
- L-tryptophan degradation IX (11/12 steps found)
- L-tryptophan degradation XII (Geobacillus) (11/12 steps found)
- mandelate degradation to acetyl-CoA (15/18 steps found)
- meta cleavage pathway of aromatic compounds (9/10 steps found)
- catechol degradation I (meta-cleavage pathway) (5/5 steps found)
- catechol degradation II (meta-cleavage pathway) (6/7 steps found)
- toluene degradation I (aerobic) (via o-cresol) (6/7 steps found)
- 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
- 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
- toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
- toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
- toluene degradation II (aerobic) (via 4-methylcatechol) (3/6 steps found)
- 4-chloronitrobenzene degradation (4/9 steps found)
- superpathway of aerobic toluene degradation (19/30 steps found)
- naphthalene degradation to acetyl-CoA (6/12 steps found)
- p-cumate degradation (3/8 steps found)
- p-cymene degradation (4/11 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Benzoate degradation via hydroxylation
- Biphenyl degradation
- Carbazole degradation
- Ethylbenzene degradation
- Fluorene degradation
- Phenylalanine metabolism
- Styrene degradation
- Toluene and xylene degradation
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.80
Use Curated BLAST to search for 4.2.1.80
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YKH9 at UniProt or InterPro
Protein Sequence (258 amino acids)
>RR42_RS27885 2-keto-4-pentenoate hydratase (Cupriavidus basilensis FW507-4G11) MTLALARRLREAEQTRTPVEPLRGEIPPGDAAMAYAIQRANVDAWRAQGRRVAGRKIGLT SPAVQRQLGVDQPDFGTLFADMVFGDDEPIPVARTLQPKAEAEVALVLCRDVPQKDATLV DLINAVAYVLPAIEVVGSRIRNWDISYVDTVADNASSGLVVLGAVPVPLAGLDLKTVKME MLRDDERVSTGSGADCLGHPLNAAVWLARKLAALGDPLRAGDLILTGALGPMVAVAPGQC FEARISGIGSVRARFAPG