Protein Info for RR42_RS27840 in Cupriavidus basilensis FW507-4G11

Annotation: 3,4-dihydroxyphenylacetate 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR02298: 3,4-dihydroxyphenylacetate 2,3-dioxygenase" amino acids 1 to 281 (281 residues), 490.3 bits, see alignment E=9.5e-152 PF02900: LigB" amino acids 7 to 279 (273 residues), 259.1 bits, see alignment E=2.1e-81

Best Hits

Swiss-Prot: 64% identical to HPCB_ECOLX: 3,4-dihydroxyphenylacetate 2,3-dioxygenase (hpcB) from Escherichia coli

KEGG orthology group: K00455, 3,4-dihydroxyphenylacetate 2,3-dioxygenase [EC: 1.13.11.15] (inferred from 86% identity to bcm:Bcenmc03_3283)

MetaCyc: 66% identical to 3,4-dihydroxyphenylacetate dioxygenase (Escherichia coli C)
3,4-dihydroxyphenylacetate 2,3-dioxygenase. [EC: 1.13.11.15]

Predicted SEED Role

"3,4-dihydroxyphenylacetate 2,3-dioxygenase (EC 1.13.11.15)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic Amin Catabolism or Aromatic amino acid degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.13.11.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YR50 at UniProt or InterPro

Protein Sequence (282 amino acids)

>RR42_RS27840 3,4-dihydroxyphenylacetate 2,3-dioxygenase (Cupriavidus basilensis FW507-4G11)
MGKLSLAAKVTHVPSMYLSELPGKHHGCREAAIAGHREIGRRCRELGVDTIVVADVHWLV
NAGYHVNCNAHFEGIYTSNELPHFIKDMAYAYDGNPELGRRIASTACEQGVMTRAHEIAS
LELEYGTLVPMRYMNADRHFKVVSIAAWCAWHQLDESRRFGEALRASIEASDANVAFLAS
GSLSHRFNDNNSPEESIHQISREFFKQVDLRVVELWKQGDWATFCRMLPEYNEHCIGEGG
MHDTAMLLGLLGWDKYDRPVEIVTDYFTSSGTGQINAIFPVR