Protein Info for RR42_RS27610 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 132 (28 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 345 to 370 (26 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details PF03092: BT1" amino acids 28 to 411 (384 residues), 55.9 bits, see alignment E=4.9e-19 PF07690: MFS_1" amino acids 36 to 357 (322 residues), 56.2 bits, see alignment E=4.2e-19 PF12832: MFS_1_like" amino acids 149 to 374 (226 residues), 26.5 bits, see alignment E=5e-10

Best Hits

KEGG orthology group: None (inferred from 91% identity to rsl:RPSI07_1864)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBQ3 at UniProt or InterPro

Protein Sequence (425 amino acids)

>RR42_RS27610 MFS transporter (Cupriavidus basilensis FW507-4G11)
MAEGSDRTLLYFGWLTLFIYLATPAGFLVDIQTSYLLKNQLHATATQISTFRLMTGIPVY
IAFAFGLARDQWNPLGLRDRGFFLIFAPVTAVAFLWIAFSGFSYAGLLIGMLLAMLSSRF
VAAAYQGLIALVGQEKRMSGRLSALCNVVSSVPVVAGAFASGYISDHLAAKEAFILVATV
TLMIAVLGLWKPASVFGQIYEQPQARGADLVGNVRRLAKHKAVYPAVLICFLWNFAPGAA
TALQFYLTNTLHASDSVYSYYNGIFAAAFIPTFLLYGFLCKKVPLNKLLCWGTIVAVPQM
IPLAFIHSANLALVLAAPIGLMGGVATAAYLDLAMRSCPPGLQGTLMMLVDGVFALSARA
GDLLGSWIYGSSPTHGFTYCVIATTVVYALILPLILLTPKELIATRDGEQNPEVEAEVLS
EIRET