Protein Info for RR42_RS26790 in Cupriavidus basilensis FW507-4G11

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 276 to 302 (27 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 244 (224 residues), 136.8 bits, see alignment E=1.2e-43 PF02687: FtsX" amino acids 282 to 395 (114 residues), 76.5 bits, see alignment E=1.8e-25

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 63% identity to gca:Galf_2066)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YB84 at UniProt or InterPro

Protein Sequence (402 amino acids)

>RR42_RS26790 peptide ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MRLTDVLDFTWQVLRGYRSRSLLILLAMGIGVAAVVAVSALGEGARLYVVNQFGALGTNL
VIVLPGRSETAGAAPGIVLGATTRDLTLDDALALRRSPAVARIAALIVGNADLHVGARRR
EAPVLGSTAELLAVRHMALAQGSFLPEGDPHHGQPVCVIGTRVAMELFGTRQALGEWLRI
GDRRFRVIGLLAGQGESLGFNTDELVIVPLSAAQALFNTDSLFRILIEAKTREQIQGAKA
DAEEIIRQRHEGKRDVTVITQDAVLATFDRILRALTLAVGGIAAISLAVAGILIMNVMLI
AVTQRQREIGLLKALGATAGHIRLLFLTEAVLLALGGVAAGLAVGEAACRLAVQLYPAIP
FTPPWWALLGAPAIAVVTAIAFTVAPAQRAAKLDPVLALSGR