Protein Info for RR42_RS26060 in Cupriavidus basilensis FW507-4G11

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 85.3 bits, see alignment E=9.9e-28 PF00158: Sigma54_activat" amino acids 148 to 313 (166 residues), 218.2 bits, see alignment E=1.7e-68 PF14532: Sigma54_activ_2" amino acids 149 to 319 (171 residues), 63.6 bits, see alignment E=7e-21 PF07728: AAA_5" amino acids 171 to 292 (122 residues), 26.6 bits, see alignment E=1.6e-09 PF02954: HTH_8" amino acids 401 to 441 (41 residues), 22.4 bits, see alignment 2.5e-08

Best Hits

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 71% identity to lch:Lcho_4338)

Predicted SEED Role

"Two component, Sigma-54 Specific, central transcriptional regulator of acidic amino acid uptake"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJ77 at UniProt or InterPro

Protein Sequence (452 amino acids)

>RR42_RS26060 Fis family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MTDTHPIRVVFVEDEEDVLVGSSQALELAGFAVNGFASVEHARGSIGIGEPVVVVCDVKL
PGMNGVAWLNEIRHIDPDLPVILMTGHGDISMAVQAMREGAYDFIEKPCSSERLVSVVRR
AADRRKLSLEVLGLREQLESWHGIQACLIGRSAQMERVRRAVRALADAPADVVIYGETGT
GKDLVARCLHDHSARRTGNFVPLNCGGLPEALAESELFGHEVGSFTGATRRRCGKFEHAQ
GGTLFLDEIESMPLSVQVKFLRALQERSIERVGSNEPIAVDCRVIAASKEDLKLLSEQKK
FRADLYYRIGVAFIDLPPLRERREDIPLLFEHLILQAATRFNRPAPVLGNAQFELLLSHS
WPGNVRELRNVADRFVLGLLSDDFELHGGHAGHGNSLPDQLEQFERVVVMEELKRNNCDV
AATAKALSIPKQTLYSKLRRLQIAYDKVQAEE