Protein Info for RR42_RS26040 in Cupriavidus basilensis FW507-4G11

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 195 to 223 (29 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 326 to 343 (18 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details PF00375: SDF" amino acids 8 to 404 (397 residues), 389.4 bits, see alignment E=9.4e-121

Best Hits

Swiss-Prot: 42% identical to DCTA_LARHH: C4-dicarboxylate transport protein (dctA) from Laribacter hongkongensis (strain HLHK9)

KEGG orthology group: None (inferred from 84% identity to rme:Rmet_1122)

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAY2 at UniProt or InterPro

Protein Sequence (437 amino acids)

>RR42_RS26040 C4-dicarboxylate ABC transporter (Cupriavidus basilensis FW507-4G11)
MKKKRPITTYIVIAMILGVIVGYSCNKAFPDPGTAKEIAGYISIFTDVFLRLIKMIIAPL
VFSTLVVGIAHMGDASTVGRVGVKALGWFIVASFLSLTLGLILATVLQPGHNIGLPLPDV
GAATNLKTNAFTLKDFITHLVPKSVAEAMATNEILQIVVFSIFFGTALSTLGETGKRLAG
VIDDLAQTMLKITGAVMWMAPVAVFAAIASTVTTQGLGILITFAKFMGSFYLGLLVLWGL
LVAAGFFFLGKRVFTLIRLIREPFLLSFSTASSEAAYPKMLTALDRFGVSRKISSFVLPM
GYSFNLDGTMMYCTFAVLFIAQAYDIHLPIGTQITMLLLLMLTSKGMAGVPRASLVVIAA
TLNQFGIPEAGLLLIMGVDQFLDMGRSATNAVGNSIAAAVVAKWEGQLASESDLESEGDS
TAAGAGAPLGKPDAVQA