Protein Info for RR42_RS25930 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): glycine dehydrogenase (deaminating) (EC 1.4.1.10)
Rationale: Specifically important for: L-Threonine. Annotated as D-amino acid dehydrogenase; SEED has it as the small subunit but do not see why another subunit is expected (i.e. E. coli dadA). Important on Thr as well as Gly because Thr is cleaved (via the threonine dehydrogenase and kbl) to glycine. The electron acceptor is uncertain -- the given EC number implies that NAD is the electron acceptor, which is consistent with an N-terminal NAD binding domain (PF13450).
Original annotation: amino acid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01266: DAO" amino acids 4 to 398 (395 residues), 231.1 bits, see alignment E=1.2e-71 PF00890: FAD_binding_2" amino acids 4 to 265 (262 residues), 31 bits, see alignment E=6.5e-11 PF13450: NAD_binding_8" amino acids 6 to 36 (31 residues), 34.7 bits, see alignment (E = 7.2e-12)

Best Hits

Swiss-Prot: 63% identical to DADA3_RHILO: D-amino acid dehydrogenase 3 (dadA3) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 84% identity to reh:H16_B0508)

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.1.10 or 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YL05 at UniProt or InterPro

Protein Sequence (422 amino acids)

>RR42_RS25930 glycine dehydrogenase (deaminating) (EC 1.4.1.10) (Cupriavidus basilensis FW507-4G11)
MKTIAVIGGGITGVTTAYALAKRGFSVTLLEKHRYAAMETSFANGGQLSASNAEVWTHWS
TILKGIKWMLKSDAPLLVNPRPSWHKLSWFAEFIAAIPHYRKNTIETTRLAIAARDHLFS
WAAAEGIDFDLKKEGILHIYRDKAGFEHAGRVSKLLAEGGLARHAVTPEEMRAIEPTLAG
QYYGGYFTQSDSTGDIHKFTSGMAAAIDRLGVRCLYNQDVQSVSTDGRQVTIVSGDGRQA
ESRVFDGVVVCAGTASRALAASLGDRVNIYPVKGYSITVNLNDAQSQAAAPVVSLLDDET
KLVTSRLGVDRFRVAGTAEFNGYNRDIRADRIRPLVEWVNQCFPGVSTRSVVPWAGLRPM
MPTMLPRVGRGRASCVFYNTGHGHLGWTLSAVTADMIGDVVQQAMGARRAHGVQEPVALV
TP