Protein Info for RR42_RS25870 in Cupriavidus basilensis FW507-4G11

Annotation: fatty acid hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 140 to 167 (28 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 356 to 373 (18 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 84 to 217 (134 residues), 107.4 bits, see alignment E=3.9e-35

Best Hits

KEGG orthology group: None (inferred from 60% identity to vpe:Varpa_0035)

Predicted SEED Role

"Sterol desaturase-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YPY2 at UniProt or InterPro

Protein Sequence (374 amino acids)

>RR42_RS25870 fatty acid hydroxylase (Cupriavidus basilensis FW507-4G11)
MEEQITVYAFPVFLLLMLVELGYGLFVGRNTYRLSDALSNLSQGLLSQLVASVSQLFQIG
LYILTWRRVALFPHAGLWGSVWGWLLAIVMFDFCDYWLHRAGHESAVFWAAHAVHHQSQD
FNLSTALRQESTVAFLGWPFYLPMALAGVAPQQFALAGLVVLLYQFWIHTEHIGKLGWFD
RVFSSPSNHRVHHAVNDQYLDKNYGGMLIIWDRLFGTFAEEAEKPVYGTRTPLNSWSLLG
AVASGYVPLWQMARRAPRWQDKIKVWFKAPGWLPPGVSDDSAPFDLERARQRFDPPLVAG
AAPVALLQFALLMAAGAGYLWQSDAMGSGLLWGLALLLVTGLAGLGGLLQGRLRPRSLLG
LDVLLLLLAGLLLR