Protein Info for RR42_RS25860 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 427 to 449 (23 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 407 (392 residues), 175 bits, see alignment E=1.1e-55

Best Hits

KEGG orthology group: K08166, MFS transporter, DHA2 family, methylenomycin A resistance protein (inferred from 73% identity to tin:Tint_2041)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKW9 at UniProt or InterPro

Protein Sequence (465 amino acids)

>RR42_RS25860 MFS transporter (Cupriavidus basilensis FW507-4G11)
MPTTTNAQRATLLAAALGFVVVLLDVSVVNVALDTLRQGFATDVAGLQWVINAYTLVFAA
LLLTSGAIGDRLGARRVFLMGLALFTLTSVACGAAGSLAMLVMARLGQGIGAALLVPNSL
SMLQRAFPDREQRSRAVGWWGAIGGISLAAGPVLGGLLVTHFGWRSIFLINLPLGLIGLY
LTLRHVAADGSGHHRGLDWPGQGAAILALAALTASVTEASRLGWGHAWVQAGLWLALASA
AAFIRIESRSAAPMLPLALLRIPAFRVASLAGVIVNFAYYGQIFVFSLFFQLQQGLSPQQ
TGLAFLPMTAVLMAVNVLAGRLITRMGARYLMVLGLLLAALGYLMLLPVRIDGPYWQLAP
PMLLAASGIALMVPTMTNVTLSAVDGSRAGIASGVLNSARQVGGMLGVAGFGYLVHDTAP
QAFMRGMHLSLGFAAALLLVGAVMCWSGIRAERPAAGKDGRQGAT