Protein Info for RR42_RS25845 in Cupriavidus basilensis FW507-4G11

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 PF00463: ICL" amino acids 98 to 265 (168 residues), 75.8 bits, see alignment E=2.7e-25 amino acids 326 to 386 (61 residues), 34.4 bits, see alignment E=9.4e-13 amino acids 438 to 526 (89 residues), 47 bits, see alignment E=1.5e-16 PF13714: PEP_mutase" amino acids 173 to 263 (91 residues), 44.8 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 82% identical to ACEA_PSEAE: Isocitrate lyase (PA2634) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 98% identity to reh:H16_A2211)

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.1

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YPX6 at UniProt or InterPro

Protein Sequence (526 amino acids)

>RR42_RS25845 isocitrate lyase (Cupriavidus basilensis FW507-4G11)
MAQYQDDIKAVAGLKENHGSAWNAINPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADSSKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAQGPAKAAIQEKIDNHVTHVVPIIAD
IDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAIR
YAFLELGVDDGVIVARTDSLGAGLTKQIAVTNTTGDLGDQYNSFLDCEELSADELGNGDV
IIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCVTALQNGADLLWIETEKPHIAQIGGM
VSEIRKVIPNAKLVYNNSPSFNWTLNFRQQVYDAMKAAGKDVSAYERTQLMNVEYDQTEL
AKLADEKIRTFQADSSREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQR
KEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQF