Protein Info for RR42_RS25820 in Cupriavidus basilensis FW507-4G11

Annotation: DNA polymerase III subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family
  • amino acids 3 to 171 (169 residues), 79.8 bits, E=1e-26
• PF00929: RNase_T
  • amino acids 6 to 159 (154 residues), 105.7 bits, E=2e-34

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 76% identity to bur:Bcep18194_A5296)

Predicted SEED Role

"DNA polymerase III alpha subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

See A0A0C4YKV3 at UniProt or InterPro

Protein Sequence (206 amino acids)

>RR42_RS25820 DNA polymerase III subunit epsilon (Cupriavidus basilensis FW507-4G11)
MQTVAVLDFETTGLSPRQGDRATEIAVVLLRGGEIVDQYQSLMNAGRRIPSDVVRLTGIT
NDMIASAPAASKVMREVAQFVGKHPVVAHNAGFDRRFWQAELSLLGMPADQAFACTMLVS
RRVYPHAQNHRLSTLVDMLRLPKAGRAHRAMADAQMTCHLWHRLQHDIAETYGMRRVDYD
LITRVQATSGAKVPALLRSLGESQAQ