Protein Info for RR42_RS25710 in Cupriavidus basilensis FW507-4G11

Annotation: Clp protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 PF00574: CLP_protease" amino acids 2 to 115 (114 residues), 148.5 bits, see alignment E=9.8e-48

Best Hits

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKS4 at UniProt or InterPro

Protein Sequence (115 amino acids)

>RR42_RS25710 Clp protease (Cupriavidus basilensis FW507-4G11)
VMFLNGEVNDAVSALVCARLLLLEAENPAKTIHLYINSPGGVITSGLAMHDTMRCMKAPV
HTLCMGAARSMGSFLPMADEPGERAALPNASLHAHQPLGGFQGQASDFLIHAEEM