Protein Info for RR42_RS25500 in Cupriavidus basilensis FW507-4G11

Annotation: cholesterol oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13450: NAD_binding_8" amino acids 12 to 41 (30 residues), 23.7 bits, see alignment (E = 9.8e-09) PF05199: GMC_oxred_C" amino acids 462 to 523 (62 residues), 57.1 bits, see alignment E=6e-19

Best Hits

KEGG orthology group: K03333, cholesterol oxidase [EC: 1.1.3.6] (inferred from 75% identity to rfr:Rfer_0318)

Predicted SEED Role

"putative cholesterol oxidase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIU3 at UniProt or InterPro

Protein Sequence (542 amino acids)

>RR42_RS25500 cholesterol oxidase (Cupriavidus basilensis FW507-4G11)
MRKTPFDFDWLIIGSGFGGSVSALRLAEKGYRVGVFERGRRYRDKDLPESAWQFRKYLWA
PRLGLKGIMRMSLFRHVFFPSQSGVGGGSTVYGGVLYRAKQEFFENAQWRELGRWEELLQ
PHYATAERMLGVKTVPFDSPNQQLARRMAQHFGTEHTFTRAPTGVFFGEPGKTVKDPYFG
GEGPDRTGCTRCGACMVGCRVGAVNSLLKNYLWFAEKRGVQILAEREVVDVRPLGAADGS
EGYRVTTQRPGSLWFGSDRQIHTARGVVFAGGSLGTNDLLANCKHGGSLPLISDRLGQLV
RTNSESVLNVRLPEDRRTWNDVTASSSVHVDHDTHIEFLTYGRNADFLSLLCTLLVGNGN
RLTRPLKWLGNVVLHPLQWCRSMWPVGWSRRMVMLLVMQTLDNAIKLRARKRWFGRGYRL
VTEQNRDKPNPTYIEVGNQAAQWLAKHTGGIAQSNVLEALGNIPTTAHVLGGAVIGADDA
SGVIDRHLHIFGYRNLLVCDGAAMPANPGVNPALTITALAEYAMAQIPPAVPAPVPESPI
AR