Protein Info for RR42_RS25420 in Cupriavidus basilensis FW507-4G11

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 PF01590: GAF" amino acids 78 to 206 (129 residues), 39.9 bits, see alignment E=1.8e-13 PF00158: Sigma54_activat" amino acids 337 to 504 (168 residues), 211.2 bits, see alignment E=2.5e-66 PF14532: Sigma54_activ_2" amino acids 338 to 509 (172 residues), 63.8 bits, see alignment E=6.2e-21 PF07728: AAA_5" amino acids 360 to 480 (121 residues), 26.3 bits, see alignment E=2e-09 PF07724: AAA_2" amino acids 360 to 474 (115 residues), 30.6 bits, see alignment E=1e-10 PF02954: HTH_8" amino acids 608 to 648 (41 residues), 41.6 bits, see alignment 2.5e-14

Best Hits

KEGG orthology group: None (inferred from 73% identity to pna:Pnap_1166)

Predicted SEED Role

"Sigma-54 dependent transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YHR0 at UniProt or InterPro

Protein Sequence (659 amino acids)

>RR42_RS25420 Fis family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MFSRPENDGRVMSAWERFQCGREADSSTLRRLIDDSWRRCQQASVNPDRANAPLPMSEDK
LHLLRDQCAELLGASTPVMALARDFLTETGTVMVLTDARGTVLNLEGDTSTLGAAENVHL
ISGANWSEPACGTNAIGTTLEIGQPVQIHSAEHYCEGIKRWSCSATVIRDPLDNSTLGVL
DVSGLTTSYSRHALALVVSTAARIEGRLAQTELDIRCSLLEACIERVTDNMSDGVILFDR
RGRAIKANGLATQMLAELGRADGRPAGPRLTEITIGGNGVPITLPAWASRDWLEPVMVSG
RQVGALLTLPFHQRARGTARSVPEPVAASSDRSFERVIGHSAAIQQTISRARHLGKSRVP
VLLLGETGVGKEVFARGIHEANADKSAPFVALNCGGLSRELLSSELFGHAEGSFTGAKRG
GMIGKIEAADGGTLFLDEIGEMPIDLQPHFLRVLEESEVYRLGENKARKVSFRLIAATHR
DLRRQISDGNFRMDLFYRIAVTSINIPPLRERADDIPLLADHYLKLLSRQHGLESVQVTP
GVLERLQDYAWPGNVREFRNVIENMLLTAGNTLITEADLPVELFQPQAGDRERMAVDNGR
RPRVLTRLEAAERRALYEAIRQCQGNMTAVARHLGIARSTLYLKLERFGLDGVVDELRS