Protein Info for RR42_RS25350 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 32 to 60 (29 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 236 to 263 (28 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 25 to 270 (246 residues), 108.7 bits, see alignment E=1.5e-35

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 76% identity to cti:pRALTA_0443)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YIQ3 at UniProt or InterPro

Protein Sequence (340 amino acids)

>RR42_RS25350 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MSKIAFCFIALCGAIFLPSLIYPVLLMKIMCFALFACAFNLLIGFTGLLSFGHAALFGAA
GYMAGYAARDLGIPIEGSIVLGVLASALLGFLMAGLAIRRKGIYFTMITLALAQMVYFVF
LQASFTGGEDGMQGIPRGKLMGMIDLSDDTVMYYVVLVIFALTLALIARIVHSPFGQILR
AVKENEPRAISLGYDADRYKLVAFILSAALTGLAGATKAFVLGFETLVDVHWQMSGLVVL
MTLVGGVGTLTGPIVGAIIILILENKLGEIGVFLADLTHIEWFGALGESVTIVTGLTFIG
CVLVFRKGVVGELNTLILNMRRSGAKSAARKDVSAVQEPS